The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of metallopeptidase containing co-catalytic metalloactive site (YP_563529.1) from Shewanella denitrificans OS217 at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 3b2y Target Id 375165
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS1651,YP_563529.1, 3.40.630.10, 92218 Molecular Weight 30303.43 Da.
    Residues 274 Isoelectric Point 5.26
    Sequence mtsrspfesfvwqseifncqsndidafyaqlaeevnrlglkkntlgsvdsfainlyqsasqrsdlpsll issgfhgeeaagpwgmlhflrglqpalfervnlsllplvnptgfkaghrfnrfgenpnrgftlengkpt pnehtslegklllehaqllcaasrdgiltchedvlmnetyvysfeptqtpgrfslglrdalgqyfklak dgfidecpvtdgvifnhfdtsfeaflvrsgaklaacsetpgqedfdrrvqansaamgqfiahcapil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.215
    Matthews' coefficent 2.02 Rfactor 0.175
    Waters 230 Solvent Content 38.98

    Ligand Information



    Protein Summary

    Gene Sden_2526 from Shewanella denitrificans os-217 encodes the YP_563529 metallopeptidase containing a Ni metal in its putative active site. YP_563529.1 sequence belongs to the PF04952 family.

    SCOP classifies 3b2y inside the alpha/beta class, phosphorylase/hydrolase-like fold, Zn-dependent exopeptidase superfamily. A Ni metal is observed in the structure chelated by the side chains of conserved residues H75, E78 and H169. Close structural similarity is observed with 3ieh and 2qvp.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch