TOPSAN > Proteins > JCSG > 3ec9

3ec9

Summary Discussions

1. Protein Summary
1. 1.1. References:
2. Ligand Summary

Molecular Characteristics
Title	Crystal structure of NTF2-like protein of unknown function (YP_440611.1) from Burkholderia thailandensis E264 at 1.60 A resolution. To be published
Site	JCSG
PDB Id	3ec9	Target Id	390600
Source	Burkholderia thailandensis e264
Alias Ids	YP_440611.1	Molecular Weight	15741.90 Da.
Residues	139	Isoelectric Point	5.61
Sequence	mrnpsedhmmrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrlge ewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqftdtllvaqamqp
	BLAST FFAS ProFunc GPSS

Structure Determination
Method	XRAY	Chains	2
Resolution (Å)	1.60	Rfree	0.198
Matthews' coefficent	2.33	Rfactor	0.168
Waters	371	Solvent Content	47.16

Ligand Information
Ligands	ACT (ACETATE) x 5;GOL (GLYCEROL) x 1
Metals

Jmol

Resources
- PDB
- PDBSum
- PSI-KB
- PlasmID
- Proteopedia

Protein Summary

YP_440611.1 from Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 /CIP 106301) encodes an alpha and beta protein that belongs to NTF2-like superfamily (FIg 1). This protein is structurally similar to 1tuh (BAL32A, Z=7.1%, RMSD=1.96A, 19% seqid), and 1oh0 (ketosteroid isomerase, Z=6.1%, RMSD=2.03A, 15% sedid). However, the active site residues of 1oh0 are not conserved in the YP_440611.1 structure.

The structure contains a SnoaL-like domain -- Rob Finn (PFAM)

Fig 1. YP_440611.1 contains one biological dimer in asu.

Fig 2. Superposition of YP_440611.1 (green), 1tuh (grey) and 1oh0 (light pink) structures. The ligand (EQU; equilenin) bound in the active site of 1oh0 is shown as stick. YP_440611.1 doesn't contain any ligand in this region.

References:

Robinson, A., Wu, P.S.-C., Harrop, S.J., Schaeffer, P.M., Dosztanyi, Z., Gillings, M.R., Holmes, A.J., Nevalainen, K.M.H., Stokes, H.W., Otting, G., Dixon, N.E., Curmi, P.M.G., Mabbutt, B.C. (2005) Integron-associated Mobile Gene Cassettes Code for Folded Proteins: The Structure of Bal32a, a New Member of the Adaptable alpha+beta Barrel Family J.Mol.Biol. 346: 1229-1241

Kim, S.W., Cha, S.S., Cho, H.S., Kim, J.S., Ha, N.C., Cho, M.J., Joo, S., Kim, K.K., Choi, K.Y., Oh, B.H. (1997) High-resolution crystal structures of delta5-3-ketosteroid isomerase with and without a reaction intermediate analogue. Biochemistry 36: 14030-14036