.
The Open Protein Structure Annotation Network
PDB Keyword
.

387085

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 387085
    Molecular Characteristics
    Source Shewanella putrefaciens cn-32
    Alias Ids TPS7481,SPUT_CN32_28JUL04_CONTIG161_REVISED_GENE2916, 87504 Molecular Weight 41082.02 Da.
    Residues 365 Isoelectric Point 5.93
    Sequence viklirqfvlphfgidateakisalgnghinetllvrwptgelvlqrintqvfktpqalvsnadkishh lcakalqqqyglkvvspcltkegelaldlgeqgfwraisylphshsievvksekeaemaakafghfasa lsdfdatqledvipqfhhlpgrmallkqaveldsqhrlafcrhwvdyavsqqalldelaeispklplri chndtkinnmlfdkrdmssmaiidldtcmkghlmydfgdmvrtfcspeaedstalenvkvrqsifaaic rgylselgnvltevekrslwlgarviclmigvrfltdylngdvyfhihreghnldraanqftlyqslld qdvalkacfelnplsavehs
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch