The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 380888
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS7295,SSUI_28JUL04_CONTIG165_REVISED_GENE281, _0000.000765_, BV1071, 86913 Molecular Weight 26486.93 Da.
    Residues 232 Isoelectric Point 5.15
    Sequence mqlklssvskkfdhkiiledtsftfeqgkiygllgrngagkttlfnciarnltldggsiqfvkdeiafd ydntdigftqtypqlpafmtayefvrfymdihkdklksprspeewlnlvgigeedrhrllkdfshgmqn kvqlllslivqppvllldepltsfdpvaahefkqlireakkdsviifsthilqlaqdlcdeivllhhqe lqavpsdklhdpdfeqevvtlltad
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch