.
The Open Protein Structure Annotation Network
PDB Keyword
.

379568

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 379568
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS7202,MMAG_12JAN01_CONTIG3872_REVISED_GENE3486, 86604 Molecular Weight 25515.82 Da.
    Residues 232 Isoelectric Point 5.75
    Sequence mssdtvkhwdtdraaaydnrvreaipgydalhvlscqivaettggkgralvigagtgaecvalaqscpn lsvvgvdpskdmlehaevkvrehnltsrvrlypskvgdlpkfepfdaatlllvmhflpddgakksllee iaahlkpgaplvladlfgtwddawqqqlrvwwrhlqlaagipevevdkgfrhvdrdifplpearltall aetgfgppepyfralcfggwvsrkv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch