The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 379354
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS7179,EXIG_01APR05_CONTIG272_REVISED_GENE787 Molecular Weight 45534.27 Da.
    Residues 394 Isoelectric Point 6.18
    Sequence velhqlkdllteklqatslihatisaprlksndlrrikvkpillrdtyaiqlefqheriikhenlsiee fivrmdqffdefrqflfrfeteevqfqlskkmkvsikttvkepiqaelshnrkkshlledgvpvpflir lgvmteegqvkrqkydkfkqinrflefvedsiavlpkgrtlrildfgcgksyltfalyhylkivkgfdl nvtgldlkkevieecaaiaadlgyddlsfrvgdvhdydqdtevdlmvtlhacdvatdvalaravdwnas vilsvpccqkelnrqldcspldvmlqhgliqekfaslatdsiraelltlvgyetqllefidlentpkni lirayknpkrpteekidryiafrellhakpylerelsgrlgqissklvq
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch