.
The Open Protein Structure Annotation Network
PDB Keyword
.

379213

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 379213
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS7162,NP_281455.1 Molecular Weight 28066.89 Da.
    Residues 239 Isoelectric Point 8.60
    Sequence mnlwdkkaktyaryqntlntiqkqtfeylqnlkisfqdksiidigcgtgvwtlhlakeakeilaldsan amleilqedakklnlnnikcknlsfetwmqnnpnvkfdlaflsmspalqnekdytnflnlakikiylgw adyrksdfldpifkyfntefkgfykkdlenyllekniffhkivfdetrkvqrtkeeaienalwhlsmnk itasketvssfvennitetieskiklliinnl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch