.
The Open Protein Structure Annotation Network
PDB Keyword
.

379209

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 379209
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS7160,NP_282560.1, 335463 Molecular Weight 29703.12 Da.
    Residues 253 Isoelectric Point 5.92
    Sequence mqklveqvwdytkhakfysyrpnyapktidmlislvgkkdikvadigagtgnlsimllergckvvsvep ndamreigiertkdqkidwvratglnstlqnsefdwvtfgssfnvmdrnealeeahrllksegyfscmw nhrdlndpvqkiaedtivefvpnytrgtrredqrpiiesrkdlfdnivyieedfyfhqsienyinawks vknpywdletdegnelfnkisnkisqrlpkefsikyttrcwsakki
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch