.
The Open Protein Structure Annotation Network
PDB Keyword
.

379011

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 379011
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS7139,YP_321612.1, 92763 Molecular Weight 24798.10 Da.
    Residues 217 Isoelectric Point 6.33
    Sequence mtannspsnskmrrqpqqarsqervnyilsaaeelfielgyeqtttraiasrakvpvgslyqffpdkes ilkalavryfqqeyqlfaqlhtkeaetlpvaayvdrvidafdhfmnshpgyravyeqllnlmtysaiea mdnyeyrivdelaaffaklnpkldaekcqaialvvvkvvsdllwlatsqtpakrqlllaetkilmlgyl nnylgnqvrd
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch