.
The Open Protein Structure Annotation Network
PDB Keyword
.

378890

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378890
    Molecular Characteristics
    Source Silicibacter pomeroyi dss-3
    Alias Ids TPS7123,YP_166167.1, _0000.000743_, 87056 Molecular Weight 21616.57 Da.
    Residues 198 Isoelectric Point 8.37
    Sequence maklyfnystmnagkstvllqashnyrergmqtylmtaaidgragtgriasrigigaeadiftprddvf amirdrlgagpvacvfvdeaqflspeqvwqlarvvddldvpvlayglrvdfqgklfpgsatllaladem revrtickcgrkatmvirqdasgraitegaqvqiggnetyvslcrkhwreatgdpgakgh
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch