The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378680
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS7105,SSUI_28JUL04_CONTIG246_REVISED_GENE1076, BV3001, _0000.000321_, _0000.000765_, BV1071, 87223 Molecular Weight 45409.33 Da.
    Residues 404 Isoelectric Point 5.10
    Sequence mvknnniavkvehvsksfklptessqslrttlvnlfkgikgyveynvlqdisfevekgdffgivgrngs gkstllkilsqiyvpergtvavdgklvsfielgvgfnpeltgkenvylngamlgftaeeidamyddive faelsefmnqklknyssgmqvrlafsvaikaqgdilildevlavgdeafqrkcndyflerkksgkttil vthdmgavkkycnkalliekgyvkalgepddvanqysfdnvlasisevteneeplhqsdivkdlqinlv sknqiepdesieiefrytvlediethvaftfldlerhfdvyndnsmdlktfgkgekffrvkcklpsinq aklkmavsvrnsnkqpllfaktsdtpaifisrkfstdniaeedaatgfiqrnsqwelld
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch