The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378374
    Molecular Characteristics
    Source Polaromonas sp. js666
    Alias Ids TPS7087,YP_549683.1, PF06167, 93121 Molecular Weight 28933.17 Da.
    Residues 261 Isoelectric Point 5.06
    Sequence mlnwlrtllgrvradpdtipetlwqhtlaqypflaqraaaeqsqlrtlagqflagkefsgaqglvvtde mavaiaaqaclpvlhlgldyyddfkgivvhpgamlarrevmddsgvvhrysevllgeamergpvtlswq dvaaagesasqgynvvvhefihkidmrdgtangcpplpsrtareawqavmqpayddfreqvamaerfgg appwldsyaatspaeffavtceayfvnrprfaqdfaalaglfdeyfrrnrlstq
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch