The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 378221
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS7061, Molecular Weight 13755.84 Da.
    Residues 124 Isoelectric Point 5.40
    Sequence msvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdlydwhnsngpaknvqsri tnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkvfhlha
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Pfam Update: This a twilightzone match to our Nuclear transport factor 2 (NTF2) domain. We are currently inves tigating mechanisms for trying to pick up these sort of sequences using the new HMMER3 tools.


    378221 from Methylobacillus flagellatus KT is characterized as a protein of unknown function. It is not found in any PFAM A families, though it has some similarity to PFAM B family PB032658 (E-value 2.2e-13).

    The monomeric and presumed biological forms are shown in in Fig 1 and 2, respectively. The fold is quite common, and is seen in a diverse range of proteins.

    Figure 1. Monomeric form of 378221 colored from blue to red (N-term to C-term).

    Figure 2. Tetrameric form of 378221.


    Ligand Summary




    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch