.
The Open Protein Structure Annotation Network
PDB Keyword
.

361004

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 361004
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS2836,YP_001814629.1, PF08000, 291485 Molecular Weight 23570.38 Da.
    Residues 204 Isoelectric Point 5.43
    Sequence mfkklaadltgfsdigqvihpddfdkaaaddyvlhedgekiyfliksktdeycftnlalvhldgesavs skrvlyrypyahypirhvmfetagtvdldveikfeiggkhysidvdkkqlehvkdlykallaiaekqye gqkmlefansslnhsvtilgglrqgdmnvpqtfkdlsqesfdwlqghyykwnqkdfgsfyekyinn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    Protein of unknown function (ZP_00539245, PF08000/DUF1696) with pleckstrin-homology domain.
    The most similar structure is protein with PDB code 1lw3. Similar structure that have residues similar to conserved amino acids of ZP_00539245 is domain of PDB structure 2aeh.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch