The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 360717
    Molecular Characteristics
    Source Borrelia burgdorferi b31
    Alias Ids TPS2795,NP_045719.1, PF05619, 90746 Molecular Weight 40356.93 Da.
    Residues 356 Isoelectric Point 6.35
    Sequence mpkdtisvsfvqnrlafnnvnyynplliyksnvlaskhlalsvtnlqdlleklemqkaqesdsskkkia eeqlsalkksmsdffgqdglksvdfyvynqikeikdflksnlhpfvvfvnqaedvissdfeeirkicnf ivistkdanlpdflkgkdkselkniiavyagkqnlhlkftaaylhqasifhavnpygmilnavpvydds lidslrktninfysllnetgndgilafkegvslsgdpidetftlfyikneaikeliriwnknnranskl gslnldgnlpneytaglecffhelkqkglivsykeiklkinsseglslslevalkyndsfnsvnliitt qeineylrras
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch