The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 359218
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS2735,NP_662050.1 Molecular Weight 24113.27 Da.
    Residues 214 Isoelectric Point 5.59
    Sequence mnyvkskqrvadhgevftpawlveamidlvkdeteridarflepacgsgnflvpilqrklaaverkfgk snfekqhyalfavmctygielladniaecranmleifadyltldesdelyraaiyvlsqnlvhgdalkm rtsdgqpiafaewgylgkgkfqrrdfrldslamsstfsvegslfahlgkheiftptrtyppmtvselaa raaeanl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch