.
The Open Protein Structure Annotation Network
PDB Keyword
.

358961

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358961
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS2712,P35236 Molecular Weight 33701.54 Da.
    Residues 296 Isoelectric Point 5.62
    Sequence ntprevtlhflrtaghpltrwalqrqppspkqleeeflkipsnfvspedldipghaskdryktilpnpq srvclgraqsqedgdyinanyirgydgkekvyiatqgpmpntvsdfwemvwqeevslivmltqlregke kcvhywpteeetygpfqiriqdmkecpeytvrqltiqyqeerrsvkhilfsawpdhqtpesagpllrlv aeveespetaahpgpivvhcsagigrtgcfiatrigcqqlkargevdilgivcqlrldrggmiqtaeqy qflhhtlalyagqlpeepsp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch