The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 358819
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS2703,1591455, 90046 Molecular Weight 11702.39 Da.
    Residues 104 Isoelectric Point 8.62
    Sequence mknevffgegmkvvkekypdlydiivklndtvftgktldyktqkliaigivasrcdevaiekqmksamk elgitkeeiadvlrvvlltsgmpaftkamkilekl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch