The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 358750
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS2700,10640157, 3.40.1190.20, 342247 Molecular Weight 32803.58 Da.
    Residues 287 Isoelectric Point 6.38
    Sequence mrflayfghlnidvlisvdsipregsvnvkdlrprfggtagnfaivaqkfripfdlysavgmkthreyl amiesmgintghvekfedesgpicyiatdgkkqvsfmhqgamekwkpqladeyeyvhfstgpnyldmak sirskiifdpsqeihkyskdelkkfheisymsifndheyrvfremtglsspkvttivtngergsslfmd gkkydfpaipssgdtvgagdsfraglylalynrrsiekgmiygtiiahhviddgienfslnmedleret enyrrmftkrs
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch