.
The Open Protein Structure Annotation Network
PDB Keyword
.

358503

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358503
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2691,TM0071 Molecular Weight 69306.97 Da.
    Residues 603 Isoelectric Point 5.55
    Sequence pniprnetfiaqvltgraanptnfnvwtgwvwqdrgiqnllleplwyvdfatgkiisalaeslptynsd fteltiklrkgvywsdgepftaddvvftietimstpafgyhqelvnevesveklddytvkiklkrpnar fhayfidrwggirpmpkhvfekvedpvnfefnppvgtgpyvlhsvdpggywtlwqrredwertptgmlf gmpqpkyvlfidygspekqvlamaqhqldeailtiealkavlnrvktarawrknfpwtvnndpcvtgfv fntakepfnnievrwaltlaidiveyaanafdgavtlspihiplstayynwyftrledwlknyeidlgn gekfkpydpeaglrlaeyakkrgysvpdspeiikrtfgpgwwkyapdvaakllekngfyrdkngkwhlp ngdlwqitiiaptnpsdpayrnafalsqawkkfgidavvqtsenansfgaegnfdvhtawpaaepwggh pdlyrtlypfhseyvvpigedapwgnycrwsdprldkiieelkntpwgntqklielgtealkiiveglp svptfnypgviawdeyywtnypgaenpytqpyqhwpnfkymlpflkptgrk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0071

    Name: Xylotriose ABC transport
    Other genes that carryout this rxn:TM0075 TM0072 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl3[e] --> adp[c] + h[c] + pi[c] + xyl3[c]

     
    Name: Xylobiose ABC transport
    Other genes that carryout this rxn:TM0075 TM0072 TM0074 TM0073
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylb[e] --> adp[c] + h[c] + pi[c] + xylb[c]

     
    Name: oligo-xylan ABC transport
    Other genes that carryout this rxn:TM0075 TM0072 TM0074 TM0073 TM0060 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xylan4[e] --> adp[c] + h[c] + pi[c] + xylan4[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0071
    generated 12/2008
    Transmembrane protein

    HMM_TM0071

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch