.
The Open Protein Structure Annotation Network
PDB Keyword
.

358489

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358489
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2688,TM1745 Molecular Weight 21165.77 Da.
    Residues 181 Isoelectric Point 4.71
    Sequence erpaferqpmgyaqqfpgcggglgygpnapmyerpqmraergfgyglklqirdeeqlklalktriaeal nnldlnddqlkelynvaketkeqldslkekfvqlheeyynalvkrdtktaedlkdqiddlrdevqdiyk dfadkvddiitvdqyrkfrgdkrmlfvlltdegfevleemvqe
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1745
    generated 12/2008
    Transmembrane protein

    HMM_TM1745

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch