The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358485
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2687,TM1693 Molecular Weight 25178.26 Da.
    Residues 218 Isoelectric Point 9.99
    Sequence frsflmrdrekarkyvlkeiekfgkraftwlfsdvvvegsenipkdrnfivvanhqslmdiplilgfva tgafiakeelrkipgvnwyirylngvfldrknprravralreaieklkngvtfivfpegtrspdgkvls fkkdslmiavktgvpvlpvsiwgtyhlipkgrwtftpgkvflkihepvdpkgfsseeelrkyveevvkr gveelkarwsk
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1693

    Name: 1-hexadecanoyl-sn-glycerol 3-phosphate O-acyltransferase (n-C16:0)
    Metabolic Subsystem: Lipid Biosynthesis
    Reaction: : 1hdecg3p + palmACP --> ACP + pa160
    Classification: EC:

    Ligand Information
    Model TM1693
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch