The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358411
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2671,TM0353, _0028.000670_ Molecular Weight 33948.73 Da.
    Residues 312 Isoelectric Point 4.85
    Sequence nrasaqtvsekdatstqapvfltytvtkenetveivgqvtadtkkvtskvsgdvleiyveegdvvqvgq kiakiddtdyqisylsalnsyktspteinrlnlekakenlenttvvspvsgvvqavnvdvgdrvsvgts ivtivetdtlrvegsiseydlknvkegmkavftfeqlgltltgkvkrispvaetsggvtvipvefsfdq tppslvipgltcdveiiikeatssffipkeavrqdqngyyvmkqtpqgpqkvyvelgeelndkieikkg vsegdvlllipsqqeiqrlrtrqglpmfgpgggrar
      BLAST   FFAS

    Ligand Information
    Model TM0353
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch