The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358403
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2669,TM0202 Molecular Weight 30731.20 Da.
    Residues 271 Isoelectric Point 5.42
    Sequence ipvvpimdgkiptdvkieiwknpeeavakivskevdfavlpvtvganlygkgvriklvgvhewkvfylv asddatfdgweslrgqevytphgrgqtvdvlmryflskagltldrdvkilyappqeivalfksgkvkya alpepfvsmcldrgkvvldfqkewgkelgvpgripiaglfvregvdketvekvekalidsirwmkenld etvqlsseklgipakilkssleriefeyvpvekcreevetflkklnelypegfekipdegfywk
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0202

    Name: bicarbonate transport via ABC
    Other genes that carryout this rxn:TM0204 TM0203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + hco3[e] --> adp[c] + h[c] + hco3[c] + pi[c]


    Ligand Information
    Model TM0202
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch