.
The Open Protein Structure Annotation Network
PDB Keyword
.

358394

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358394
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2663,TM0080 Molecular Weight 30070.14 Da.
    Residues 274 Isoelectric Point 4.91
    Sequence dnagrvveitsapervvslspaatrflvflgledkivgvtdydsyeaekvgamvpvniekvvslnpdlv lmfggfqlpevpklekaglkvlvvnpnslndiirdvvllgtifdrrdlalekseklrekmleigkktyn vppskrpkvlylisspgpdvkeiwtcgmgsylneiislaggvniasgiagpngwpqlsieyvvsqnpdv iivgvyipgteneeikkilnfepfkeinavknkrvfavdgnvasqpspdvfelldlfyeffyggkge
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0080

    Name: iron (III) transport via ABC system
    Other genes that carryout this rxn: TM0079 TM0078 TM0189 TM0191 TM0190
    Metabolic Subsystem: Transport
    Reaction: atp[c] + fe3[e] + h2o[c] --> adp[c] + fe3[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0080
    generated 12/2008
    Transmembrane protein

    HMM_TM0080

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch