The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358391
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2662,TM0056 Molecular Weight 72863.11 Da.
    Residues 631 Isoelectric Point 4.98
    Sequence yatpeeyykatgkkiteyhespmltklveegklppveqrlpeeplvvqpvekvgqfggtwrrvwkgpsd rwgisklievklafwdkeggklvpglakswevlengrvyifhlrkgvkwsdgapytahdivfwvndivg ndditpskpdwynigvkvealddytvkfefskpyglfllkvpyggftgapahylkqfhpkytpmeeiek kmvegvhntwvdlfndkndflentelptlspwkpitdpteqfyilernpyfwavdiegnqlpyidyvrh eyvkndevillkaisgeidmqwrhigglgagagnftllmensqsggyrvlkwiaangsasrislnyahs devlrkvfndvrfrqalslainreeineilfnglaeprqaslvsgspyfdpewekayaeydpdrankll demglkwddkheyrllpdgrplrftitvtgqfhvdvwtmvkeywkqigvwveienlerslfyeradagd fdamvwnmdraaqplsspmvifpgseniadfwyigwsgwisyyidknirgvepeevpegpeppevvyrl vdlyyqiastpdpdkikelmaeatkihrenlwmigtvgedlspaiaknnfrnvpeflvtddvlrtplna mpmqffieqk
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0056

    Name: D-xylose transport via ABC system
    Other genes that carryout this rxn:TM0114 TM0112 TM0115 TM0060 TM0058 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl-D[e] --> adp[c] + h[c] + pi[c] + xyl-D[c]


    Ligand Information
    Model TM0056
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch