.
The Open Protein Structure Annotation Network
PDB Keyword
.

358367

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358367
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2656,TM1706 Molecular Weight 10571.55 Da.
    Residues 95 Isoelectric Point 4.95
    Sequence imeieqilsnaeiiedseesdevtlgkwvviknldtgeehkfrivtpqeadffaqklssdsplgksllg rkvgdvvkvkapsgvqryqviavmnk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1706
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch