.
The Open Protein Structure Annotation Network
PDB Keyword
.

358017

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358017
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS2601,SMU.1760C Molecular Weight 33080.56 Da.
    Residues 291 Isoelectric Point 5.12
    Sequence mleqkidfmvtvevreanangdplsvnmprtdakdyglmsdvsikrkirnrmqdmgqpifvqardrvdd ciyslkqrlenkeffdtvkegskkkksvenfvkqinaewldvrsfgqvfafdgysaanvrgpvsiswak slekvvtqsmqitkstnselnsktelesstmgtkhfvdygvyvikgsinpnfaektgfsdadaeiikev lvslfendassarpegsmrvrevfwfthsnklgnvssarvfdllefdkekqdkdsyedyaihlnqeela eyeakglqveiiegl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch