.
The Open Protein Structure Annotation Network
PDB Keyword
.

358000

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358000
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS2596,SMU.719C, _0115.000254_, BIG_206, 89888, 282518 Molecular Weight 51048.42 Da.
    Residues 434 Isoelectric Point 6.29
    Sequence mkekvfrdpvhnyipvedeliydlinskefqrlrrikqlgsssftfhgaehsrfshclgvyylarrvtn ifdkkysdiwnsneslltmtaallhdighgayshtferlfdtnhetitqqiilspeteintilrrvspd fpdkvasvinhtysnkqveqlissqidvdrmdyllrdsyftgasygefdltrvlrvirpiengiafsrd gmhavedyiisryqmymqvyfhpasramevllqnllkrakylypkekefftvtsphlipffenrvtled ylslddgvmntyfqtwmqsadkilsdlasrfinrkvfksitfdekdlsnleklrkivkdlgfdptyyta lhlnfdlpydvykpdvqnprtqiemlqedgsiaelstlsplvhtlsgtthgdrrfyfpkemlikdglfv eakekfshyiknkhfynlre
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch