The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357993
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS2594,SMU.248 Molecular Weight 46133.62 Da.
    Residues 420 Isoelectric Point 4.95
    Sequence mtkesiltfsqskaepawlqekrlaafdkiddlelpriervkfqrwnlgdgtitespisanvpdftsfg enpklvqlgtqtvleslpaklveqgvvftdfhsaleeipqviekyfatalkfdedklsayhtayfnsgs vlyvpdnveidlplegiflqdstsnvplnkhvliiagrhakvnylerfetigdsdvkataniavevlaq agsqvkfaaidrlgnnittyisrrgrldndasidwalgvmnegnviadfdsdligngshaelkvvaass grqiqgidtrvtnygnnsighilqhgvilergtltfngighiikgakgadaqqesrvlmlsdkarsdan pillidenevtaghaasigqvdpedmyylmsrgidketaerlvirgflgtviteipvkavrdemiavld ekldkr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch