.
The Open Protein Structure Annotation Network
PDB Keyword
.

357889

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357889
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS2566,3258113 Molecular Weight 18249.32 Da.
    Residues 166 Isoelectric Point 9.37
    Sequence maviklktplsleeilklnvgdlvylsgviytardlahkrflsqgfpfnpegaviyhsgplvkdkrivs agpttstrmnpyldflfskgirgiigkggmnpepfkgkavyfafpggagslaakhltiknvyweelgmt davweleakelpllvaidakgrslydrh
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch