The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357518
    Molecular Characteristics
    Source Neisseria meningitidis z2491
    Alias Ids TPS2553,7380218 Molecular Weight 18025.72 Da.
    Residues 157 Isoelectric Point 5.05
    Sequence mtdfsvwetapfgatvdhilqryhnvhraqfeelvplaqkvaqvhadtfpaeiaellaymqnellmhmm keermlfpminqgvgrgaampisvmmheheehdraiarlkeltdnfqapegacgswtrlyalakemved lndhihlendilfarvlds
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch