.
The Open Protein Structure Annotation Network
PDB Keyword
.

357312

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357312
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS2529,1788157 Molecular Weight 64635.49 Da.
    Residues 603 Isoelectric Point 5.93
    Sequence mnpqllrvtnriiersretrsaylarieqaktstvhrsqlacgnlahgfaacqpedkaslksmlrnnia iitsyndmlsahqpyehypeiirkalheanavgqvaggvpamcdgvtqgqdgmelsllsreviamsaav glshnmfdgalflgvcdkivpgltmaalsfghlpavfvpsgpmasglpnkekvrirqlyaegkvdrmal leseaasyhapgtctfygtantnqmvvefmgmqlpgssfvhpdsplrdaltaaaarqvtrmtgngnewm pigkmidekvvvngivallatggstnhtmhlvamaraagiqinwddfsdlsdvvplmarlypngpadin hfqaaggvpvlvrellkagllhedvntvagfglsrytlepwlnngeldwregaeksldsnviasfeqpf shhggtkvlsgnlgravmktsavpvenqvieapavvfesqhdvmpafeaglldrdcvvvvrhqgpkang mpelhklmpplgvlldrcfkialvtdgrlsgasgkvpsaihvtpeaydggllakvrdgdiirvngqtge ltllvdeaelaarephipdlsasrvgtgrelfsalreklsgaeqgatcitf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch