.
The Open Protein Structure Annotation Network
PDB Keyword
.

356743

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 356743
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS2462,10173509 Molecular Weight 55984.66 Da.
    Residues 512 Isoelectric Point 5.08
    Sequence meklqesmyqlivetstnlpndvrraiaeakakenagtraalslstitenikmadenispicqdtgmpt feikvpvgvnqiemkkaiyaaieqatkdgklrpnsvdsltgknsgnnlgegtpvihfeqweedyidarl ilkgggcenkniqyslpaeleglgragrdldgirkcimhsvyqaqgqgcsagfigvgiggdrttsysla keqlfrkvddvnpnddlrkleeyvlenanklgigtmgfggeatllgckvgamnrlpasffvsvayncwa frrlgveldaetgeikkwlykdgervdlnevasqvaataettevrevvleapvteeqirelkvgdvvii ngmlhtgrdaihhhlmdhdapidldgqiiyhcgpvmlqddagewhvkaagpttsireepyqgdimkkfg iravigkggmgpktlkalqehggvylnaiggaaqyyadcikkvkgvdlmefgipeamwhlevegfaaiv tmdshgnslhedvdksslekleqfaekvf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch