The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 356573
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS2442,NP_147303.1, PF03069, 282513 Molecular Weight 41049.70 Da.
    Residues 377 Isoelectric Point 5.43
    Sequence mvtritinrgkrcvdeadrchnrwhpdiepaaevdpgdivvietrdaldgqitanpgvddvasadlnvv hpltgpvyvrgakpgdllvvevldikaepfgftvaipgfgflrdlfdkpykirwrieggyafsedlpnv ripgdpflgvmgvapskellkeikeredrllkrggfvlpptpegavpprepvaseglrtipprenggnl dvrhfspgskiyfpvfvegalfsvgdahyaqgdgevcgtaiemgatatlrfgvisegakkygirfpifk psessvrrfthskhvavtgvgvidslnesenatlsakhallnlinllekagytreqayllasvaadlrl sqlvdvpnftvtaflpldifieppevlkklae
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch