.
The Open Protein Structure Annotation Network
PDB Keyword
.

354611

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 354611
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS2403,13278494, 282087, 89615, 89839, 89784, 282269, 282748 Molecular Weight 32752.77 Da.
    Residues 288 Isoelectric Point 5.89
    Sequence maaalqrieqlssrvvrvlgcnpgpmtlqgtntylvgtgsrrilidtgepsvpeyisclkqalvefdta iqeilvthwhsdhsggivdickninndttycikklrrnpqreeiigngeqqfiyiengdvvktegatlr vlytpghtddhmallleeenaifsgdcilgegttifedlydymnslnnllkikaniiypghgpvihnae akileyishrnnreeqiislfrdnfeksftvtelrtmiykdvpenlhkmaehnlllhlrklekdgkify tttpvkkwkavl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch