.
The Open Protein Structure Annotation Network
PDB Keyword
.

354605

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 354605
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS2402,13435483 Molecular Weight 73211.73 Da.
    Residues 638 Isoelectric Point 5.38
    Sequence mdafekvrtrletqpqeeyevvnaeikhggfvyyqegcclvrskdeeadsdnyevlfnleelkldqpfi dcirvapdekyvaakirtedsetstlvvvklsdqpvmeasfpnvssfewvkdeededvlfytfqrnlrc hdvyratfgdnkrnerfytekdpsyfvflyltkdsrfltlnimnkttsevwlidglspwdppvliqkri hgmlyyvehrddelyiltnvgeptefklmrtaadapaimnwdlfftmkrntkvvdldmfkdhcvlflkh snllyvnvigladdsvrslklppwacgfimdtnsdpkncpfqlcspirppkyytykfaegklfeetghe dpitktsrvlrieakskdgklvpmtvfhktdsedlqrkpllvhvygaygmdlkmnfrpekrvlvddgwi laychvrgggelglqwhadgrltkklngladlvaciktlhsqgfsqpslttlsafsaggvlvgalcnsk pellravtleapfldvlntmldttlpltleeleewgnpssdekhknyikrycpcqnikpqhypsvhita yendervplkgivnyteklkeavaehtkgagegyqppniildiqpggnhviedshkkittqmkflyeel gldstdafealkkylkf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch