.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rkh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative AphA-like transcription factor (ZP_00208345.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2rkh Target Id 377966
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS1703,MMAG_12JAN01_CONTIG3800_REVISED_GENE1537, 336990 Molecular Weight 19607.36 Da.
    Residues 179 Isoelectric Point 4.86
    Sequence mfadntltpkeavrlcalgtiasqpmryselagsvrhftsrimgpslelmgisiellryeglveavddg qgmeddamlaisaagrrelhslltarlrpgsdlsklvvalkmrflglmeaeerahqidlliegvdsela rladlrgsdgeggsalaawldhdmallesrlawledfrarl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.256
    Matthews' coefficent 2.55 Rfactor 0.212
    Waters 57 Solvent Content 51.85

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rkh
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The Magn03008610 gene from Magnetospirillum magnetotacticum ms-1 encodes a two-domain, all-alpha protein of unknown function. There are no PfamA entries for this protein but HHPred strongly suggests homology with the transcriptional activator PadR-like family (PF03551, P-value 7.3E-31, residues 7-91) and a virulence C-terminal domain (PF10400, P-value 1.8E-14, residues 101-179). This function is supported by structural similarity (PDB id: 1YG2, FATCAT P-value 1.10e-08). 

     

    Of note, this gene is elsewhere described as an alanyl-tRNA synthetase (COG0013, EC 6.1.1.7) in what is likely a misannotation.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch