.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rhm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of putative kinase (ZP_00765535.1) from Chloroflexus aurantiacus J-10-fl at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2rhm Target Id 377939
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS1702,CAUR_25MAY01_CONTIG1062_REVISED_GENE931 Molecular Weight 21073.11 Da.
    Residues 192 Isoelectric Point 6.31
    Sequence vqtpaliivtghpatgkttlsqalatglrlpllskdafkevmfdglgwsdrewsrrvgataimmlyhta atilqsgqslimesnfrvdldtermqnlhtiapftpiqircvasgdvlverilsriaqgarhpghcddr spadlelvrsrgdipplplggplltvdttfpeqidmnaivqwvrqhlqsgtafl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.221
    Matthews' coefficent 2.10 Rfactor 0.181
    Waters 611 Solvent Content 41.44

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Caur_3907 gene from Chloroflexus aurantiacus j-10-fl encodes the YP_001637473 sequence (obsolete entry ZP_00765535), a 192 residues long protein showing a weak hit with the zeta toxin group (PF06414). Its sequence profile is characterized by the conserved motif G11-//-G16-K17-T18. In the tetrameric crystal structure residues G16 and T18 of each monomer are chelating a Cl ion together with 2 ordered water molecules.

     

    SCOP classifies 2rhm in the alpha/beta class, P-loop containing nucleoside triphosphate hydrolase superfamily, nucleoside/nucleotide kinase family. Reliable structural similarity (FFAS scr=-33; HHpred P-val=1e-28; Dali Z-scr=15; FATCAT P-val=1e-8) is observed with PDB:1qf9, a UMP/CMP kinase [Ref]; and with PDB:1rkb, a human adenylate kinase [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. Schlichting I and Reinstein J pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog. Nat Struct Biol. 1999 Aug; 6(8):721-3 PubMed HubMed doi:10.1038/11485 pmid:10426946.

       


      Discuss this publication
    2. Ren H, Wang L, Bennett M, Liang Y, Zheng X, Lu F, Li L, Nan J, Luo M, Eriksson S, Zhang C, and Su XD The crystal structure of human adenylate kinase 6: An adenylate kinase localized to the cell nucleus. Proc Natl Acad Sci U S A. 2005 Jan 11; 102(2):303-8 PubMed HubMed doi:10.1073/pnas.0407459102 pmid:15630091.

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch