| Title | Crystal structure of putative kinase (ZP_00765535.1) from Chloroflexus aurantiacus J-10-fl at 1.70 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 377939 | | Molecular Characteristics | | Source | Chloroflexus aurantiacus j-10-fl | | Alias Ids | TPS1702,CAUR_25MAY01_CONTIG1062_REVISED_GENE931 | Molecular Weight | 21073.11 Da. | | Residues | 192 | Isoelectric Point | 6.31 | | Sequence | vqtpaliivtghpatgkttlsqalatglrlpllskdafkevmfdglgwsdrewsrrvgataimmlyhta atilqsgqslimesnfrvdldtermqnlhtiapftpiqircvasgdvlverilsriaqgarhpghcddr spadlelvrsrgdipplplggplltvdttfpeqidmnaivqwvrqhlqsgtafl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.70 | Rfree | 0.221 | | Matthews' coefficent | 2.10 | Rfactor | 0.181 | | Waters | 611 | Solvent Content | 41.44 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The Caur_3907 gene from Chloroflexus aurantiacus j-10-fl encodes the YP_001637473 sequence (obsolete entry ZP_00765535), a 192 residues long protein showing a weak hit with the zeta toxin group (PF06414). Its sequence profile is characterized by the conserved motif G11-//-G16-K17-T18. In the tetrameric crystal structure residues G16 and T18 of each monomer are chelating a Cl ion together with 2 ordered water molecules.
SCOP classifies 2rhm in the alpha/beta class, P-loop containing nucleoside triphosphate hydrolase superfamily, nucleoside/nucleotide kinase family. Reliable structural similarity (FFAS scr=-33; HHpred P-val=1e-28; Dali Z-scr=15; FATCAT P-val=1e-8) is observed with PDB:1qf9, a UMP/CMP kinase [Ref]; and with PDB:1rkb, a human adenylate kinase [Ref].
Ligand Summary
References