.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rhm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative kinase (ZP_00765535.1) from Chloroflexus aurantiacus J-10-fl at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2rhm Target Id 377939
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS1702,CAUR_25MAY01_CONTIG1062_REVISED_GENE931, 335703 Molecular Weight 21073.11 Da.
    Residues 192 Isoelectric Point 6.31
    Sequence vqtpaliivtghpatgkttlsqalatglrlpllskdafkevmfdglgwsdrewsrrvgataimmlyhta atilqsgqslimesnfrvdldtermqnlhtiapftpiqircvasgdvlverilsriaqgarhpghcddr spadlelvrsrgdipplplggplltvdttfpeqidmnaivqwvrqhlqsgtafl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.221
    Matthews' coefficent 2.10 Rfactor 0.181
    Waters 611 Solvent Content 41.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rhm
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. SA-Mot: a web server for the identification of motifs of interest extracted from protein loops
    L Regad, A Saladin, J Maupetit, C Geneix - Nucleic acids , 2011 - Oxford Univ Press
     

    Protein Summary

    The Caur_3907 gene from Chloroflexus aurantiacus j-10-fl encodes the YP_001637473 sequence (obsolete entry ZP_00765535), a 192 residues long protein showing a weak hit with the zeta toxin group (PF06414). Its sequence profile is characterized by the conserved motif G11-//-G16-K17-T18. In the tetrameric crystal structure residues G16 and T18 of each monomer are chelating a Cl ion together with 2 ordered water molecules.

     

    SCOP classifies 2rhm in the alpha/beta class, P-loop containing nucleoside triphosphate hydrolase superfamily, nucleoside/nucleotide kinase family. Reliable structural similarity (FFAS scr=-33; HHpred P-val=1e-28; Dali Z-scr=15; FATCAT P-val=1e-8) is observed with PDB:1qf9, a UMP/CMP kinase [Ref]; and with PDB:1rkb, a human adenylate kinase [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch