.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rha

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted DNA-binding transcriptional regulator (YP_496351.1) from Novosphingobium aromaticivorans DSM 12444 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 2rha Target Id 376212
    Related PDB Ids 2qtq 
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS1668,YP_496351.1, _0018.001261_, 383137 Molecular Weight 24112.22 Da.
    Residues 212 Isoelectric Point 6.21
    Sequence mssdvqkgdnletpgardlllqtasnimregdvvdislselslrsglnsalvkyyfgnkagllkalldr dmenivksvdallakddmspeaklrrhiskcidtyydypylnrllmrlvrdsdeaeakriadqyllplh raynrfigegvkagvfrpinpqlfyftvtgaadrffsarlvlkhcfdqdtlteqlrdsyrehtvdfima gilah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.202
    Matthews' coefficent 6.01 Rfactor 0.170
    Waters 202 Solvent Content 79.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rha
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Multidisciplinary Approaches to Study O-Antigen: Antibody Recognition in Support of the Development of Synthetic Carbohydrate-Based Enteric Vaccines
    FX Theillet, P Chassagne, M Delepierre - Anticarbohydrate , 2012 - Springer
     

    Protein Summary

    The Saro_1072 gene from Novosphingobium aromaticivorans DSM 12444 encodes for the YP_496351 protein which shows weak similarity to transcriptional regulators in archaea and bacteria, including the antibiotics responsive tetR regulatory proteins (PF00440, COG1309).

    The protein possesses a classical helix-turn-helix DNA binding motif located in the N-terminus of the protein and has an all alpha topology. 2qtq belongs to the SCOP homeodomain-like superfamily, N-terminal domain tetracyclin repressor-like family. 2qtq shows 90% sequence identity with another structure solved by PSI (PDB:2qtq), and according to DALI , it is structurally similar to PDB:1pb6 (Z=16), PDB:2gen (Z=14), PDB:3him (Z=13), PDB:2nx4 (Z=12) and others. 

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch