.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rh0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of NudC domain-containing protein 2 (13542905) from Mus musculus at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 2rh0 Target Id 380417
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1756,13542905 Molecular Weight 17272.55 Da.
    Residues 153 Isoelectric Point 4.99
    Sequence feersgvvpcgtpwgqwyqtleevfievqvppgtraqdiqcglqsrhvalavggreilkgklfdstiad egtwtledrkmvrivltktkrdaancwtslleseyaadpwvqdqmqrkltlerfqkenpgfdfsgaeis gnytkggpdfsnlek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.235
    Matthews' coefficent 2.48 Rfactor 0.190
    Waters 403 Solvent Content 50.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rh0
    1. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    2. Structural features and chaperone activity of the NudC protein family
    M Zheng, T Cierpicki, AJ Burdette - Journal of Molecular , 2011 - Elsevier
     
    3. The [] active life'of Hsp90 complexes
    C Prodromou - Biochimica et Biophysica Acta (BBA)-Molecular Cell , 2011 - Elsevier
     
    4. The crystal structure of the AF2331 protein from Archaeoglobus fulgidus DSM 4304 forms an unusual interdigitated dimer with a new type of _+ _ fold
    S Wang, O Kirillova, M Chruszcz, D Gront - Protein , 2009 - Wiley Online Library
     

    Protein Summary

    The Nudcd2 (nuclear move domain of nuclear distribution gene C homolog) gene from Mus musculus encodes a CS domain (PF04969) encountered in all domains of life that adopts an HSP20 chaperone-like fold and shows strong similarity to other domains from the same family solved by structural genomics (PDB id: 2O30, 1WFI). NudC has been implicated in cell division through interaction with molecular motors such as dynein [Ref], [Ref] while in mammals, it is also involved in metastasis [Ref], cell invasion and proliferation [Ref], regulation of the inflammatory response [Ref] and blood clot formation [Ref].

     

    To do: compare domain combinations/gene fusions of NudC in eukaryotes and prokaryotes.

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    4. (No Results)

       


      Discuss this publication
    5. (No Results)

       


      Discuss this publication
    6. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch