.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rgq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal Structure of Domain of Unknown Function with a Cystatin-Like Fold (ZP_00111510.1) from Nostoc punctiforme PCC 73102 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2rgq Target Id 378141
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1711,NPUN_22DEC03_CONTIG1_REVISED_GENENPR3134 Molecular Weight 16098.37 Da.
    Residues 143 Isoelectric Point 4.93
    Sequence meltaldkleimelaarfemsldkedvenylatfasdgalqgfwgiakgkeelrqgfyamldtfargkr hcssnaiiqgnydeatmesyltvvnredlnragsafvkdqvrkingkwylilrqievdpslpllqqsqq agana
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.196
    Matthews' coefficent 2.34 Rfactor 0.163
    Waters 439 Solvent Content 47.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Npun_R3134 gene from Nostoc punctiforme pcc 73102 encodes the YP_001866547 protein of unknown function that adopts a cystatin-like fold. HHPred strongly predicts homology of Npun_R3134 with the ring hydroxylating beta subunit of nonheme iron-containing dioxygenases (PF00866, P-value 6.8E-18 over residues 17-130), the association domain of protein kinases (PF08332, P-value 3E-15 over residues 7-123), scytalone dehydratases (PF02982, P-value 1.8E-11 over residues 2-129) and other members of the NTF2 clan all of which adopt the same (cystatin-like) fold.

     SCOP classifies 2rgq in the alpha+beta class, cystatin-like fold, NTF2-like superfamily, Rv3472-like family. DALI top hits are with the Rv3472 protein PDB:2chc (Z=19), the uncharacterized protein PDB:3b8l (Z=18), and the putative scyalone dehydratase PDB:3ef8 (Z=17).

     

    To do: look for presence of active site residues, iron/aromatic compound binding site; compare oligomerization states in the different members of the clan.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch