.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rfr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_001166107.1) from Novosphingobium aromaticivorans DSM 12444 at 1.16 A resolution. To be published
    Site JCSG
    PDB Id 2rfr Target Id 378075
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS1707,SARO_25NOV03_CONTIG22_REVISED_GENE168, 3.10.450.50, 336082 Molecular Weight 16712.87 Da.
    Residues 154 Isoelectric Point 6.42
    Sequence mddltnlaarlrlledreeireliarygpladsgdaealselwvedgeyavvgfatakgraaiaalidg qthralmadgcahflgpatvtvegdtatarchsvvfrcvsgtfgshrvsanrwtfrrtpagwravrren alldgsaaarallqfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.16 Rfree 0.172
    Matthews' coefficent 2.56 Rfactor 0.141
    Waters 272 Solvent Content 51.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rfr
    1. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary

    The Saro_3722 gene from Novosphingobium aromaticivorans dsm 12444 encodes the YP_001166107 protein of unknown function that adopts a cystatin-like fold, inside the SCOP NTF2-like superfamily, RV3472-like family.  There are no PfamA or PfamB matches for this protein although HHPred give strong hits with families from the NTF2 clan (PF00866, PF08332, PF02982, PF02156 and PF07858). Genome context analysis provides a functional link (scored 0.86) with the alcohol dehydrogenase Zn-binding domain Saro_3723.

    DALI top hits is with the RV3472 protein PDB:2chc (22% sequence identity, Z=18).  

    The structure shows significant similarity to numerous other members of the same clan determined by structural genomics [PDB:2rgq (topsan, Z=17), PDB:3cu3 (topsan, Z=17), PDB:3ef8 (topsan, Z=16), PDB:3ejv (topsan, Z=16), PDB:3hx8 (topsan, Z=16), PDB:3b8l (27% sequence identity, topsan, Z=15), PDB:3cnx (24% sequence identity, topsan, Z=15), PDB:3gzr (topsan, Z=15)].

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch