.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rff

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative nucleotidyltransferase (NP_343093.1) from Sulfolobus solfataricus at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2rff Target Id 376473
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1680,NP_343093.1, 335951 Molecular Weight 12822.29 Da.
    Residues 110 Isoelectric Point 6.33
    Sequence mgkgksaiesqirmlklakeiveevassfpnleevyifgsrargdyldtsdidilfvfkgikemnvfdr mymvsrfirgnvdyivldegekdrvkdkvlfwkrekgfvll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.187
    Matthews' coefficent 1.85 Rfactor 0.145
    Waters 107 Solvent Content 33.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rff
    1. Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB
    M Morar, K Bhullar, DW Hughes, M Junop, GD Wright - Structure, 2009 - Elsevier
     
    2. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    3. Expression, purification, crystallization and preliminary X-ray crystallographic analysis of the hyperthermophilic nucleotidyltransferase TTHA1015 from Thermus
    Y Lin, S Chen, S Si, Y Xie - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary

     The SSO1673 gene from Sulfolobus solfataricus encodes a putative nucleotidyltransferase (PF01909, COG1708, EC 2.7.7.-) that adopts a nucleotidyltransferase fold and shows significant structural similarity with antibiotic nucleotidyltransferases (PDB id: 1KNY, 3JZ0) and other nucleotidyltransferases determined by structural genomics (PDB id: 1YLQ).

     

    To do: carry out closer comparison of antibiotic nucleotidyltransferases with SSO1673

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch