The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of General Stress Protein COG3871 (YP_263493.1) from Psychrobacter arcticus 273-4 at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 2re7 Target Id 380202
    Molecular Characteristics
    Source Psychrobacter arcticus 273-4
    Alias Ids TPS1750,YP_263493.1, Molecular Weight 14872.01 Da.
    Residues 133 Isoelectric Point 4.95
    Sequence msnqkhidkiqavikdvkfamistsnkkgdihawpmttsevnldnkeiwfigdktsdvvkdiqddarig ltyatqdeknyvsisgdaelptdkakldelwspvysaffangkedaniqlikvvphgvecwlsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.226
    Matthews' coefficent 3.39 Rfactor 0.191
    Waters 24 Solvent Content 63.71

    Ligand Information


    Google Scholar output for 2re7
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Performance of phased rotation, conformation and translation function: accurate protein model building with tripeptidic and tetrapeptidic fragments
    F Pavelcik, J Vaclavik - Acta Crystallographica Section D: Biological , 2010 - scripts.iucr.org
    3. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org

    Protein Summary

    The Psyc_0186 gene from Psychrobacter arcticus 273-4 encodes the YP_263493 protein, a putative pyridoxamine 5'-phosphate oxidase found in all domains of life (PF01243, EC

    The 2re7 structure belongs to the SCOP all beta class, FMN-binding split barrel superfamily, PNP-oxidase like family. According to DALI, 2RE7 shows strong structural similarity (rmsd <2Å, >100 aligned residues) to other structural genomics structures (PDB ids: 2FHQ [Z=18], 2I02 [Z=18], 3EC6 [Z=17], 2ASF [Z=15], 2HQ7 [Z=16], 2HTI [Z=14], 2HTD [Z=13], 2QEA [Z=14], 3DMB [Z=15]) from the same family.



    To do: check dimerization mode, FMN and substrate binding site conservation, connection to stress/salvage pathways.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch