.
The Open Protein Structure Annotation Network
PDB Keyword
.

2re2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of protein of unknown function (NP_394501.1) from Thermoplasma acidophilum at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 2re2 Target Id 376464
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1679,NP_394501.1, 336065 Molecular Weight 12492.53 Da.
    Residues 117 Isoelectric Point 5.80
    Sequence mkfavavsgdrvngpgeseevqiyetdggnvrliekysnpalnataargvfmlksaldhganalvlsei gspgfnfiknkmdvyivpempvadalklilegkvspatapthdhghhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.179
    Matthews' coefficent 2.06 Rfactor 0.161
    Waters 336 Solvent Content 40.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2re2
    1. NMR structure of the protein NP_247299. 1: comparison with the crystal structure
    K Jaudzems, M Geralt, P Serrano - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary

     

    Gene Ta1041m from Thermoplasma acidophilum encodes the NP_39401 protein from the NifX family (PF02579), which contains mostly iron-molybdenum cofactors (FeMo-co) involved in nitrogen fixation. Interestingly, the Thermoplasma acidophilum protein appears out of context,  is not a part of nif operon, but instead appears as a neighbor of a protein from DUF1288 family, a genomic context conserved in few other thermophilic bacteria.

    Literature references for the NifX family

    Rubio LM, Rangaraj P, Homer MJ, Roberts GP, Ludden PW; , J Biol Chem 2002;277:14299-14305.: Cloning and mutational analysis of the gamma gene from Azotobacter vinelandii defines a new family of proteins capable of metallocluster binding and protein stabilization. PUBMED:11823455

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch