The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein conserved in bacteria with a cystatin-like fold (YP_051588.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 2.32 A resolution. To be published
    Site JCSG
    PDB Id 2rcd Target Id 372199
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1603,YP_051588.1, BIG_414, 3.10.450.50 Molecular Weight 14367.49 Da.
    Residues 128 Isoelectric Point 5.36
    Sequence mlpddvnqadvladvtaafyryekaltgndvavldelfwhdektvrygagenlygieeirafrlarpsa gldralrntvittyghdmavasteftrtgstkigrqmqtwvkmpegwrivaahvslmse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.32 Rfree 0.242
    Matthews' coefficent 2.62 Rfactor 0.187
    Waters 109 Solvent Content 52.97

    Ligand Information


    Google Scholar output for 2rcd
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    The ECA3500 gene from Erwinia carotovora atroseptica scri1043 encodes the YP_051588 amino acid sequence, belonging to the DUF3225 group (PF11533). ECA3500 is functionally associated via analysis of its genome vicinity with ECA3499, a probable amidase (YP_051587).

    SCOP classifies 2rcd in the alpha+beta class, cystatin-like fold, NTF2-like superfamily, ketosteroid isomerase-like family. According to DALI, 2rcd is structurally similar to PDB entries: 2owp (Z-scr=22; 48% seq.id.) and 3cnx (Z-scr=16).

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch