.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rbd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a domain with unknown function and a ferritin-like fold (NP_243224.1) from Bacillus halodurans at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 2rbd Target Id 378013
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1704,NP_243224.1, 335681 Molecular Weight 18834.37 Da.
    Residues 170 Isoelectric Point 5.18
    Sequence mgilsgnpqdeplhygevfstwtylstnnglingyrsfinhtgdedlknlideaiqamqdenhqleell rsngvglppappdrpaarlddipvgarfndpeisatismdvakglvtcsqiigqsiredvalmfsqfhm akvqfggkmlklnknkgwlippplhsdrpike
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.54 Rfree 0.188
    Matthews' coefficent 2.46 Rfactor 0.159
    Waters 439 Solvent Content 49.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The BH2358 gene from Baccilus halodurans encodes a protein that according to FFAS belongs to PF07875: Coat F domain (FFAS score: -13.900) and COG5577: Spore coat protein (FFAS score: -29.200). The structure is a four helix bundle and has a ferritin-like fold. However, it also has structural similarity and weak, non-significant sequence similarity to the Dps family.  There are several Dps family members and homologs in PDB.


    Top Dali hits are:

     
    No: Chain Z rmsd lali nres %id PDB Description
    1:  2rbd-A 28.8  0.0  159   159  100 PDB  MOLECULE: BH2358 PROTEIN;                                            
       2:  2rbd-B 26.7  0.4  156   156  100 PDB  MOLECULE: BH2358 PROTEIN;                                            
       3:  3fse-B 16.1  3.0  143   349   15 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING DJ-1/THIJ/PFPI-LIKE          
       4:  2fjc-O 15.8  2.5  131   150   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
       5:  2fjc-C 15.8  2.5  131   150   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
       6:  2fjc-H 15.7  2.5  132   151   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
       7:  2fjc-D 15.7  2.5  131   151   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
       8:  2fjc-L 15.7  2.3  130   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
       9:  2fjc-M 15.7  2.4  131   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      10:  2fjc-K 15.7  2.5  131   151   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
      11:  2fjc-G 15.7  2.5  131   150   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
      12:  2fjc-N 15.7  2.4  131   150   11 PDB  MOLECULE: ANTIGEN TPF1;                                              
      13:  2fjc-P 15.7  2.4  131   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      14:  2fjc-J 15.7  2.4  131   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      15:  2fjc-A 15.7  2.3  130   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      16:  2fjc-I 15.7  2.3  130   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      17:  2fjc-F 15.7  2.3  131   151   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      18:  2fjc-E 15.7  2.3  130   150   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      19:  2fjc-B 15.6  2.5  134   156   10 PDB  MOLECULE: ANTIGEN TPF1;                                              
      20:  2d5k-D 15.6  2.0  128   147    9 PDB  MOLECULE: DPS FAMILY PROTEIN;                                        
      21:  2d5k-C 15.6  1.9  127   147    9 PDB  MOLECULE: DPS FAMILY PROTEIN;                                        
      22:  2ib0-A 15.6  3.2  133   142   11 PDB  MOLECULE: CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN;               
      23:  1jig-A 15.5  1.9  126   146   11 PDB  MOLECULE: DLP-2;                                                     
      24:  2iy4-A 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      25:  2iy4-C 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      26:  2iy4-R 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      27:  2iy4-G 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      28:  2iy4-Q 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      29:  2iy4-S 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      30:  2d5k-A 15.5  2.0  128   148    9 PDB  MOLECULE: DPS FAMILY PROTEIN;                                        
      31:  1jig-B 15.5  1.9  126   146   11 PDB  MOLECULE: DLP-2;                                                     
      32:  1jig-D 15.5  1.9  126   146   11 PDB  MOLECULE: DLP-2;                                                     
      33:  2iy4-O 15.5  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      34:  3hiu-B 15.5  2.7  133   146    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
      35:  3hiu-A 15.5  2.3  129   142    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
      36:  2d5k-B 15.4  2.0  128   149    9 PDB  MOLECULE: DPS FAMILY PROTEIN;                                        
      37:  2iy4-F 15.4  1.8  127   151    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      38:  2bkc-B 15.4  1.9  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      39:  2bkc-C 15.4  1.8  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      40:  2bjy-I 15.4  1.8  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      41:  2iy4-K 15.4  1.8  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      42:  1jig-C 15.4  1.9  126   146   11 PDB  MOLECULE: DLP-2;                                                     
      43:  3hiu-C 15.4  2.3  129   144    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
      44:  1nfv-F 15.4  2.5  133   170    9 PDB  MOLECULE: BACTERIOFERRITIN;                                          
      45:  3hiu-D 15.3  2.6  132   152    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN;                                   
      46:  2bkc-M 15.3  1.9  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      47:  2iy4-N 15.3  1.9  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      48:  2bjy-J 15.3  1.9  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      49:  2bjy-C 15.3  1.8  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN;                         
      50:  2bjy-G 15.3  1.9  126   150    7 PDB  MOLECULE: NON-HEME IRON-CONTAINING FERRITIN; 
    

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch