.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rb7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of co-catalytic metallopeptidase (YP_387682.1) from Desulfovibrio desulfuricans G20 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2rb7 Target Id 375105
    Molecular Characteristics
    Source Desulfovibrio desulfuricans g20
    Alias Ids TPS1647,DDES_06JUN05_CONTIG143_REVISED_GENEDDE1186, 3.40.630.10, 292257 Molecular Weight 39680.04 Da.
    Residues 363 Isoelectric Point 5.47
    Sequence vssmqhiveltsdlirfpsmhsrpeqisrcagfimdwcaqngihaermdhdgipsvmvlpekgraglll mahidvvdaeddlfvprvendrlygrganddkyavalglvmfrdrlnalkaagrsqkdmalgllitgde eiggmngaakalpliradyvvaldggnpqqvitkekgiidikltctgkaahgarpwmgvnavdllmedy trlktlfaeenedhwhrtvnlgriragestnkvpdvaegwfnirvtehddpgalidkirktvsgtvsiv rtvpvflaadspyterllalsgatagkahgasdarylgengltgvvwgaegfntlhsrdeclhipslqs iydplmqlaremeehaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.180
    Matthews' coefficent 2.44 Rfactor 0.154
    Waters 916 Solvent Content 49.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rb7
    1. Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate
    AT Brunger, D Das, AM Deacon, J Grant - Section D: Biological , 2012 - scripts.iucr.org
     
    2. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary

    YP_387682 is a co-catalytic metallopeptidase with significant structural (PDB: 1cg2, 2f7v, 2pok, 1vgy, 1fno, 1lfw, 1r3n, and 1xmb), and sequence similarity to zinc metallopeptidases (PF01546) and acetylornithine deacetylases/succinyl-diaminopimelate desuccinylases (COG0624).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch