The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative lipase (NP_343859.1) from Sulfolobus solfataricus at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2rau Target Id 375699
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1659,NP_343859.1, 335922 Molecular Weight 40447.89 Da.
    Residues 353 Isoelectric Point 5.52
    Sequence myeewkivkreapilgndqlieniwkmkredspydiislhkvnligggndavlilpgtwssgeqlvtis wngvhytipdyrksivlylarngfnvytidyrthyvppflkdrqlsftanwgwstwisdikevvsfikr dsgqeriylagesfggiaalnysslywkndikglilldggptkhgirpkfytpevnsieemeakgiyvi psrggpnnpiwsyalanpdmpspdpkyksisdflmdslyvtgsanpydypyskkedmfpilasfdpywp yrlslerdlkfdyegilvptiafvserfgiqifdskilpsnseiillkgyghldvytgensekdvnsvv lkwlsqqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.188
    Matthews' coefficent 3.44 Rfactor 0.158
    Waters 333 Solvent Content 64.22

    Ligand Information


    Google Scholar output for 2rau
    1. A novel esterase Sso2518 from Sulfolobus solfataricus with a much lower temperature optimum than the growth temperature
    J Wang, J Wang, X Gong, G Zheng - Biotechnology letters, 2010 - Springer

    Protein Summary

    Protein NP_343859.1 should be a homolog to human gastric lipase (PDB ID: 1HLG) and aclacinomycin methylesterase (PDB ID: 1Q0R) according to the results from Dali search. There is a fatty acid molecule built in the model of NP_343859.1. Correspondingly, there is a PEG molecule in the structure of 1Q0R. By superposing comparison, NP_343859.1 carries the conversed residue Ser 151 and His 328 as in 1HLG and 1Q0R.  NP_343859.1 exists in each asymmetric unit as a monomer. Both SEC result and interface interaction calculation suggests the Biomolecule as a dimer.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch